RESEARCH USE ONLY: All products are intended strictly for laboratory research use only. Not for human consumption, clinical, diagnostic, or therapeutic use. Terms & Conditions

FOX04-DRI (10 mg)

RESEARCH USE ONLY

A specialized, cell-permeable D-retro-inverso peptide designed to selectively disrupt the interaction between FOXO4 and p53, characterized for research applications involving cellular senescence, apoptosis induction in senescent cells (senolysis), and tissue homeostasis.

Trust & Quality Verification

  • Research Use Only. Not for human or veterinary use.
  • 99% Purity Replacement Guarantee
  • Verifiable purity via HPLC & Mass Spectrometry
  • Supplied as lyophilized powder for stability during transport and storage
  • Certificate of Analysis (COA) available per lot
  • Safety Data Sheet (SDS) available

$180.00

Out of stock

Email when stock available

SKU: V-FOX-10MG Categories: ,

99%+

Purity Standard

HPLC

Verified Analysis

COA

Available

Free

Shipping

Description

FOXO4-DRI is a synthetic, reduced-size peptide modified with D-amino acids in a retro-inverso sequence to enhance stability and biological half-life. It functions as a specific antagonist to the interaction between the transcription factor FOXO4 and the tumor suppressor p53. In senescent cells, FOXO4 sequesters p53 in the nucleus, preventing it from inducing apoptosis.

By competitively inhibiting this binding, FOXO4-DRI releases p53, allowing it to activate mitochondrial apoptotic pathways (via BAX/PUMA) specifically in senescent cells. This “senolytic” capability makes it a critical tool in research focused on aging, tissue fibrosis, and chemotherapy resistance, where the elimination of senescent cells is a primary investigational endpoint.

Biochemical Characteristics

Chemically, FOXO4-DRI is distinguished by its D-retro-inverso modification, which renders it resistant to intracellular peptidases while maintaining the 3D-structural capability to bind the FOXO4 binding domain on p53.

  • Sequence/Structure: Peptide (D-retro-inverso modification).
  • Permeability: Contains a TAT-like cell-penetrating sequence, allowing efficient uptake into complex tissue models.
  • Stability: The inclusion of D-amino acids protects the peptide from rapid proteolytic degradation, significantly extending its stability in culture media and in vivo models compared to L-amino acid counterparts.
  • Specificity: Designed to selectively target the FOXO4-p53 interface, which is preferentially maintained in senescent cells, thereby minimizing impact on proliferating, healthy cells.

Chemical Properties

Property Specification
Molecule Name FOXO4-DRI
Synonyms FOXO4 D-Retro-Inverso; Proxofim-related peptide
Sequence H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH (D-isoforms)
Molecular Formula C₂₂₈H₃₈₈N₈₆O₇₈S₂ (Typical)
Molecular Weight 5358.1 g/mol
Form Lyophilized Powder
Purity ≥99% (Verified via HPLC)
Solubility Soluble in water and organic solvents (refer to SDS)
Documentation COA available per lot; SDS available

FOXO4-DRI is strictly for laboratory research and is commonly employed in the following investigational areas:

Cellular Senescence and Chondrocyte Biology

FOXO4-DRI is utilized to selectively eliminate senescent cells from in vitro expanded tissues. Research involving human chondrocytes demonstrates its utility in clearing senescent cells to improve the quality of tissue engineering constructs, without affecting the viability of healthy, proliferating chondrocytes.

Pulmonary Fibrosis and ECM Regulation

In models of bleomycin-induced pulmonary fibrosis, FOXO4-DRI is used to investigate the role of myofibroblasts in tissue scarring. Studies quantify the peptide’s ability to ameliorate fibrosis by targeting myofibroblasts and modulating the ECM-receptor interaction pathway.

Endocrine Aging and Leydig Cell Function

Researchers employ FOXO4-DRI to study age-related testosterone insufficiency. Experimental protocols involve treating aged models to assess the elimination of senescent Leydig cells and the subsequent restoration of testosterone secretion and testicular function.

Oncology and Radiosensitivity

In cancer research, specifically non-small cell lung cancer (NSCLC), FOXO4-DRI is investigated for its potential to enhance radiosensitivity. Researchers measure changes in apoptosis rates and cell survival following combined treatment with radiation, providing data on overcoming therapeutic resistance.

Pathway / Mechanistic Context

The primary mechanism of action for FOXO4-DRI in research settings is the disruption of the FOXO4-p53 axis.

  • Senescence Maintenance: In senescent cells, FOXO4 is upregulated and binds to p53, sequestering it in the nucleus and preventing it from initiating the intrinsic apoptotic pathway.
  • Inhibition: FOXO4-DRI mimics the p53-binding domain of FOXO4, competitively displacing p53 from the endogenous FOXO4 complex.
  • Resulting Flux: Freed p53 interacts with mitochondrial pro-apoptotic factors (such as Bax), leading to the selective apoptosis (senolysis) of the senescent cell.

Preclinical Research Summary

Published preclinical literature documents investigations of FOXO4-DRI across multiple experimental models for pathway characterization and endpoint measurement:

  • Lung Fibrosis: Studies indicate that FOXO4-DRI targets myofibroblasts in the lung, significantly reducing fibrosis scores and collagen deposition in bleomycin-induced mouse models.
  • Reproductive Aging: Research in aged male mice suggests that targeting senescent Leydig cells with FOXO4-DRI can alleviate age-related declines in testosterone and improve markers of testicular health.
  • Tissue Engineering: In vitro experiments with human chondrocytes show that FOXO4-DRI selectively removes senescent cells, which is critical for maintaining the regenerative potential of expanded cell populations.
  • Cancer Therapy: Data from NSCLC cell lines suggest that FOXO4-DRI pretreatment increases sensitivity to radiation therapy, potentially through the promotion of p53-mediated apoptosis in resistant tumor cells.

Form & Analytical Testing

This material is produced via robust solid-phase peptide synthesis and supplied as a lyophilized (freeze-dried) powder.

  • Lyophilization: Removes water content under vacuum to maintain peptide integrity and extend shelf-life.
  • Identity Verification: Each lot undergoes Mass Spectrometry (MS) to confirm molecular weight and identity.
  • Purity Verification: High-Performance Liquid Chromatography (HPLC) is performed to ensure the product meets the ≥99% purity standard required for reproducible research data.

Referenced Citations

References are provided for informational purposes only and are not clinical claims.

  • Zhao, Y., Zhang, J., & Han, X. (2019). FOXO4 D-retro-inverso peptide increases radiosensitivity of non-small cell lung cancer cells. Chinese journal of radiological medicine and protection, 39, 881-886. https://doi.org/10.3760/CMA.J.ISSN.0254-5098.2019.12.001
  • Han, X., Yuan, T., Zhang, J., Shi, Y., Li, D., Dong, Y., & Fan, S. (2022). FOXO4 peptide targets myofibroblast ameliorates bleomycin‐induced pulmonary fibrosis in mice through ECM‐receptor interaction pathway. Journal of Cellular and Molecular Medicine, 26, 3269 – 3280. https://doi.org/10.1111/jcmm.17333
  • Zhang, C., Xie, Y., Chen, H., Lv, L., Yao, J., Zhang, M., Xia, K., Feng, X., Li, Y., Liang, X., Sun, X., Deng, C., & Liu, G. (2020). FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice. Aging (Albany NY), 12, 1272 – 1284. https://doi.org/10.18632/aging.102682
  • Huang, Y., He, Y., Makarcyzk, M., & Lin, H. (2021). Senolytic Peptide FOXO4-DRI Selectively Removes Senescent Cells From in vitro Expanded Human Chondrocytes. Frontiers in Bioengineering and Biotechnology, 9. https://doi.org/10.3389/fbioe.2021.677576
  • Stable at room temperature for up to 90 days. For long-term storage, keep at -20°C (-4°F) or colder.
  • Once mixed with a solvent (e.g., bacteriostatic water), the solution must be stored at 4 °C (39°F) and utilized within 30 days. Avoid repeated freeze-thaw cycles, as this degrades the peptide structure.

RESEARCH USE ONLY

This product is intended strictly for laboratory research use only. It is not for human or veterinary use. It is not intended for diagnosis, treatment, cure, or prevention of any disease. All purchases are subject to our Terms of Service and Purity Guarantee.

No COAs available for this product.

Reviews

There are no reviews yet.

Be the first to review “FOX04-DRI (10 mg)”

Your email address will not be published. Required fields are marked *

RESEARCH USE ONLY

This product is intended strictly for laboratory research use only. It is not for human or veterinary use. It is not intended for diagnosis, treatment, cure, or prevention of any disease. All purchases are subject to our Terms of Service and Purity Guarantee.

0